SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g07465

Feature Type:gene_model
Chromosome:Gm15
Start:5232944
stop:5234070
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g07465
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G21620AT Annotation by Michelle Graham. TAIR10: glycine-rich protein | chr4:11491519-11491914 FORWARD LENGTH=131 SoyBaseE_val: 1.00E-19ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_C6TKQ7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TKQ7_SOYBN SoyBaseE_val: 1.00E-95ISS
UniRef100_H6WX59UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glycine-rich protein n=1 Tax=Medicago sativa RepID=H6WX59_MEDSA SoyBaseE_val: 7.00E-22ISS

Expression Patterns of Glyma15g07465
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g07465 not represented in the dataset
Glyma15g07465 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g07465
ParalogEvidenceComments
Glyma13g31840 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g07465 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g068900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g07465
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g07465
>Glyma15g07465.1   sequence type=CDS   gene model=Glyma15g07465   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAACCTACGATCACCATTTTGTTCTCTCTACTACTTTTCATAGCTTCACCCTCCTTGGCAACCCGACCCGCATCCAACCCTGATCAAGTCATGCACTCCAAGGACAACAAAAACAACAACAACCAAGGTGATGGTGGTGGGTTCTTTGGCCCCGGAGGAAGGTTCAGCATACCCGGTTTTGGAAACGGGTTTGGAAATGGCATCATAGGAGGAGGATACGGATCCGGGTATGGAGGTCCGAATGGTGGCTCCTCTAAAGGTGGTATCATACGACCAACCGTTCTGTGCAAAGACAAAGGCCCTTGTTTCCAAAAGAAGGTTACTTGTCCTGCCAAGTGCTTCTCCTCATTCAGCCGCTCCGGCAAGGGCTACGGCGCCGGTGGCGGTGGCGGTGGCTGCACCGTTGATTGCAAAAAGAAGTGCATCGCTTATTGCTAA
Predicted protein sequences of Glyma15g07465
>Glyma15g07465.1   sequence type=predicted peptide   gene model=Glyma15g07465   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKPTITILFSLLLFIASPSLATRPASNPDQVMHSKDNKNNNNQGDGGGFFGPGGRFSIPGFGNGFGNGIIGGGYGSGYGGPNGGSSKGGIIRPTVLCKDKGPCFQKKVTCPAKCFSSFSRSGKGYGAGGGGGGCTVDCKKKCIAYC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo